$ cat recipes/orchard-winter-ontario-corn-pepper-pancake-hash-081994.md

Orchard Winter Ontario Corn Pepper Pancake Hash No. 081994

Name: Orchard Winter Ontario Corn Pepper Pancake Hash No. 081994
Prep time: 25 min
Cook time: 45 min
Total time: 70 min
Yield: 5 servings
Ingredients: orchard winter ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Orchard Winter Ontario Corn Pepper Pancake Hash No. 081994 is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainerweight-lossathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Orchard Winter Ontario Corn Pepper Pancake Hash No. 081994

^_^ cozy
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       25 min
cook       45 min
total      70 min
servings   5
protein    28 g
pantry     63/100

categorybreakfastdietpescatarianleveleasykcal341

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard winter ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.