$ cat recipes/rainy-day-brazilian-spinach-feta-scramble-plate-3314.md

Rainy-Day Brazilian Spinach Feta Scramble Plate

Name: Rainy-Day Brazilian Spinach Feta Scramble Plate
Prep time: 23 min
Cook time: 19 min
Total time: 42 min
Yield: 5 servings
Ingredients: rainy-day brazilian spinach; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Rainy-Day Brazilian Spinach Feta Scramble Plate is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Rainy-Day Brazilian Spinach Feta Scramble Plate

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       23 min
cook       19 min
total      42 min
servings   5
protein    42 g
pantry     93/100

categorybreakfastdietpescatarianleveleasykcal271

$ price recipe --region auto

Estimating local basket...

Ingredients

rainy-day brazilian spinach
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.