$ cat recipes/rainy-day-indian-garlic-butter-overnight-oat-bake-4104.md

Rainy-Day Indian Garlic Butter Overnight Oat Bake

Name: Rainy-Day Indian Garlic Butter Overnight Oat Bake
Prep time: 17 min
Cook time: 39 min
Total time: 56 min
Yield: 5 servings
Ingredients: rainy-day indian garlic; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Rainy-Day Indian Garlic Butter Overnight Oat Bake is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Rainy-Day Indian Garlic Butter Overnight Oat Bake

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       17 min
cook       39 min
total      56 min
servings   5
protein    40 g
pantry     91/100

categorybreakfastdietpescatarianleveleasykcal591

$ price recipe --region auto

Estimating local basket...

Ingredients

rainy-day indian garlic
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.