$ cat recipes/rainy-day-japanese-corn-pepper-scramble-bake-4809.md

Rainy-Day Japanese Corn Pepper Scramble Bake

Name: Rainy-Day Japanese Corn Pepper Scramble Bake
Prep time: 20 min
Cook time: 34 min
Total time: 54 min
Yield: 5 servings
Ingredients: rainy-day japanese corn; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Rainy-Day Japanese Corn Pepper Scramble Bake is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Rainy-Day Japanese Corn Pepper Scramble Bake

-_- calm
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       20 min
cook       34 min
total      54 min
servings   5
protein    31 g
pantry     97/100

categorybreakfastdietpescatarianleveleasykcal216

$ price recipe --region auto

Estimating local basket...

Ingredients

rainy-day japanese corn
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.