$ cat recipes/rainy-day-japanese-lemon-herb-pancake-plate-3914.md

Rainy-Day Japanese Lemon Herb Pancake Plate

Name: Rainy-Day Japanese Lemon Herb Pancake Plate
Prep time: 19 min
Cook time: 39 min
Total time: 58 min
Yield: 5 servings
Ingredients: rainy-day japanese lemon; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Rainy-Day Japanese Lemon Herb Pancake Plate is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Rainy-Day Japanese Lemon Herb Pancake Plate

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       19 min
cook       39 min
total      58 min
servings   5
protein    40 g
pantry     92/100

categorybreakfastdietpescatarianlevelmediumkcal421

$ price recipe --region auto

Estimating local basket...

Ingredients

rainy-day japanese lemon
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.