$ cat recipes/rainy-day-mexican-pesto-kale-yogurt-cup-bake-4909.md

Rainy-Day Mexican Pesto Kale Yogurt Cup Bake

Name: Rainy-Day Mexican Pesto Kale Yogurt Cup Bake
Prep time: 12 min
Cook time: 12 min
Total time: 24 min
Yield: 5 servings
Ingredients: rainy-day mexican pesto; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Rainy-Day Mexican Pesto Kale Yogurt Cup Bake is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Rainy-Day Mexican Pesto Kale Yogurt Cup Bake

-_- calm
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       12 min
cook       12 min
total      24 min
servings   5
protein    37 g
pantry     90/100

categorybreakfastdietpescatarianleveleasykcal486

$ price recipe --region auto

Estimating local basket...

Ingredients

rainy-day mexican pesto
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.