$ cat recipes/rainy-day-ontario-miso-scallion-overnight-oat-bake-4609.md

Rainy-Day Ontario Miso Scallion Overnight Oat Bake

Name: Rainy-Day Ontario Miso Scallion Overnight Oat Bake
Prep time: 14 min
Cook time: 40 min
Total time: 54 min
Yield: 5 servings
Ingredients: rainy-day ontario miso; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Rainy-Day Ontario Miso Scallion Overnight Oat Bake is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Rainy-Day Ontario Miso Scallion Overnight Oat Bake

-_- calm
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       14 min
cook       40 min
total      54 min
servings   5
protein    19 g
pantry     70/100

categorybreakfastdietpescatarianleveleasykcal656

$ price recipe --region auto

Estimating local basket...

Ingredients

rainy-day ontario miso
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.