$ cat recipes/rainy-day-taiwanese-coconut-lime-egg-muffin-bake-4504.md

Rainy-Day Taiwanese Coconut Lime Egg Muffin Bake

Name: Rainy-Day Taiwanese Coconut Lime Egg Muffin Bake
Prep time: 7 min
Cook time: 27 min
Total time: 34 min
Yield: 5 servings
Ingredients: rainy-day taiwanese coconut; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Rainy-Day Taiwanese Coconut Lime Egg Muffin Bake is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Rainy-Day Taiwanese Coconut Lime Egg Muffin Bake

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       7 min
cook       27 min
total      34 min
servings   5
protein    26 g
pantry     63/100

categorybreakfastdietpescatarianleveleasykcal201

$ price recipe --region auto

Estimating local basket...

Ingredients

rainy-day taiwanese coconut
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.