$ cat recipes/signal-fall-brazilian-pesto-kale-smoothie-cup-095189.md

Signal Fall Brazilian Pesto Kale Smoothie Cup No. 095189

Name: Signal Fall Brazilian Pesto Kale Smoothie Cup No. 095189
Prep time: 10 min
Cook time: 32 min
Total time: 42 min
Yield: 5 servings
Ingredients: signal fall brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Signal Fall Brazilian Pesto Kale Smoothie Cup No. 095189 is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Signal Fall Brazilian Pesto Kale Smoothie Cup No. 095189

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       10 min
cook       32 min
total      42 min
servings   5
protein    35 g
pantry     68/100

categorybreakfastdietpescatarianleveleasykcal516

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal fall brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.