$ cat recipes/signal-fall-brazilian-sesame-ginger-egg-bake-093309.md

Signal Fall Brazilian Sesame Ginger Egg Bake No. 093309

Name: Signal Fall Brazilian Sesame Ginger Egg Bake No. 093309
Prep time: 24 min
Cook time: 20 min
Total time: 44 min
Yield: 5 servings
Ingredients: signal fall brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Signal Fall Brazilian Sesame Ginger Egg Bake No. 093309 is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Signal Fall Brazilian Sesame Ginger Egg Bake No. 093309

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       24 min
cook       20 min
total      44 min
servings   5
protein    21 g
pantry     93/100

categorybreakfastdietpescatarianleveleasykcal536

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal fall brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.