$ cat recipes/signal-fall-french-garlic-butter-overnight-oat-bake-093104.md

Signal Fall French Garlic Butter Overnight Oat Bake No. 093104

Name: Signal Fall French Garlic Butter Overnight Oat Bake No. 093104
Prep time: 25 min
Cook time: 29 min
Total time: 54 min
Yield: 5 servings
Ingredients: signal fall french; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Signal Fall French Garlic Butter Overnight Oat Bake No. 093104 is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Signal Fall French Garlic Butter Overnight Oat Bake No. 093104

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       25 min
cook       29 min
total      54 min
servings   5
protein    22 g
pantry     93/100

categorybreakfastdietpescatarianleveleasykcal301

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal fall french
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.