$ cat recipes/signal-fall-indian-miso-scallion-yogurt-cup-stack-096979.md

Signal Fall Indian Miso Scallion Yogurt Cup Stack No. 096979

Name: Signal Fall Indian Miso Scallion Yogurt Cup Stack No. 096979
Prep time: 12 min
Cook time: 22 min
Total time: 34 min
Yield: 5 servings
Ingredients: signal fall indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Signal Fall Indian Miso Scallion Yogurt Cup Stack No. 096979 is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Signal Fall Indian Miso Scallion Yogurt Cup Stack No. 096979

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       12 min
cook       22 min
total      34 min
servings   5
protein    17 g
pantry     78/100

categorybreakfastdietpescatarianlevelmediumkcal596

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal fall indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.