$ cat recipes/signal-fall-korean-lemon-herb-pancake-plate-092914.md

Signal Fall Korean Lemon Herb Pancake Plate No. 092914

Name: Signal Fall Korean Lemon Herb Pancake Plate No. 092914
Prep time: 27 min
Cook time: 29 min
Total time: 56 min
Yield: 5 servings
Ingredients: signal fall korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Signal Fall Korean Lemon Herb Pancake Plate No. 092914 is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Signal Fall Korean Lemon Herb Pancake Plate No. 092914

^_^ cozy
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       27 min
cook       29 min
total      56 min
servings   5
protein    22 g
pantry     94/100

categorybreakfastdietpescatarianleveleasykcal621

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal fall korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.