$ cat recipes/signal-fall-ontario-sweet-potato-breakfast-wrap-bake-093709.md

Signal Fall Ontario Sweet Potato Breakfast Wrap Bake No. 093709

Name: Signal Fall Ontario Sweet Potato Breakfast Wrap Bake No. 093709
Prep time: 14 min
Cook time: 8 min
Total time: 22 min
Yield: 5 servings
Ingredients: signal fall ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Signal Fall Ontario Sweet Potato Breakfast Wrap Bake No. 093709 is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Signal Fall Ontario Sweet Potato Breakfast Wrap Bake No. 093709

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       14 min
cook       8 min
total      22 min
servings   5
protein    7 g
pantry     65/100

categorybreakfastdietpescatarianleveleasykcal636

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal fall ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.