$ cat recipes/signal-holiday-french-sesame-ginger-overnight-oat-stack-093124.md

Signal Holiday French Sesame Ginger Overnight Oat Stack No. 093124

Name: Signal Holiday French Sesame Ginger Overnight Oat Stack No. 093124
Prep time: 19 min
Cook time: 17 min
Total time: 36 min
Yield: 5 servings
Ingredients: signal holiday french; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Signal Holiday French Sesame Ginger Overnight Oat Stack No. 093124 is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Signal Holiday French Sesame Ginger Overnight Oat Stack No. 093124

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       19 min
cook       17 min
total      36 min
servings   5
protein    8 g
pantry     67/100

categorybreakfastdietpescatarianleveleasykcal551

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal holiday french
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.