$ cat recipes/signal-holiday-indian-corn-pepper-pancake-hash-096994.md

Signal Holiday Indian Corn Pepper Pancake Hash No. 096994

Name: Signal Holiday Indian Corn Pepper Pancake Hash No. 096994
Prep time: 13 min
Cook time: 13 min
Total time: 26 min
Yield: 5 servings
Ingredients: signal holiday indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Signal Holiday Indian Corn Pepper Pancake Hash No. 096994 is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Signal Holiday Indian Corn Pepper Pancake Hash No. 096994

^_^ cozy
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       13 min
cook       13 min
total      26 min
servings   5
protein    16 g
pantry     79/100

categorybreakfastdietpescatarianleveleasykcal661

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal holiday indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.