$ cat recipes/signal-holiday-korean-tomato-basil-pancake-cup-092934.md

Signal Holiday Korean Tomato Basil Pancake Cup No. 092934

Name: Signal Holiday Korean Tomato Basil Pancake Cup No. 092934
Prep time: 21 min
Cook time: 17 min
Total time: 38 min
Yield: 5 servings
Ingredients: signal holiday korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Signal Holiday Korean Tomato Basil Pancake Cup No. 092934 is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Signal Holiday Korean Tomato Basil Pancake Cup No. 092934

^_^ cozy
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       21 min
cook       17 min
total      38 min
servings   5
protein    8 g
pantry     68/100

categorybreakfastdietpescatarianleveleasykcal381

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal holiday korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.