$ cat recipes/signal-holiday-taiwanese-corn-pepper-overnight-oat-stack-098174.md

Signal Holiday Taiwanese Corn Pepper Overnight Oat Stack No. 098174

Name: Signal Holiday Taiwanese Corn Pepper Overnight Oat Stack No. 098174
Prep time: 11 min
Cook time: 27 min
Total time: 38 min
Yield: 5 servings
Ingredients: signal holiday taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Signal Holiday Taiwanese Corn Pepper Overnight Oat Stack No. 098174 is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Signal Holiday Taiwanese Corn Pepper Overnight Oat Stack No. 098174

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       11 min
cook       27 min
total      38 min
servings   5
protein    26 g
pantry     62/100

categorybreakfastdietpescatarianleveleasykcal221

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal holiday taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.