$ cat recipes/signal-late-night-japanese-miso-scallion-smoothie-bake-096604.md

Signal Late-Night Japanese Miso Scallion Smoothie Bake No. 096604

Name: Signal Late-Night Japanese Miso Scallion Smoothie Bake No. 096604
Prep time: 9 min
Cook time: 19 min
Total time: 28 min
Yield: 5 servings
Ingredients: signal late-night japanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Signal Late-Night Japanese Miso Scallion Smoothie Bake No. 096604 is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Signal Late-Night Japanese Miso Scallion Smoothie Bake No. 096604

^_^ cozy
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       9 min
cook       19 min
total      28 min
servings   5
protein    42 g
pantry     94/100

categorybreakfastdietpescatarianleveleasykcal441

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal late-night japanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.