$ cat recipes/signal-late-night-ontario-lemon-herb-breakfast-wrap-cup-093739.md

Signal Late-Night Ontario Lemon Herb Breakfast Wrap Cup No. 093739

Name: Signal Late-Night Ontario Lemon Herb Breakfast Wrap Cup No. 093739
Prep time: 16 min
Cook time: 28 min
Total time: 44 min
Yield: 5 servings
Ingredients: signal late-night ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Signal Late-Night Ontario Lemon Herb Breakfast Wrap Cup No. 093739 is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Signal Late-Night Ontario Lemon Herb Breakfast Wrap Cup No. 093739

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       16 min
cook       28 min
total      44 min
servings   5
protein    43 g
pantry     67/100

categorybreakfastdietpescatarianleveleasykcal276

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal late-night ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.