$ cat recipes/signal-late-night-ontario-lemon-herb-oat-cup-093734.md

Signal Late-Night Ontario Lemon Herb Oat Cup No. 093734

Name: Signal Late-Night Ontario Lemon Herb Oat Cup No. 093734
Prep time: 23 min
Cook time: 31 min
Total time: 54 min
Yield: 5 servings
Ingredients: signal late-night ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Signal Late-Night Ontario Lemon Herb Oat Cup No. 093734 is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Signal Late-Night Ontario Lemon Herb Oat Cup No. 093734

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       23 min
cook       31 min
total      54 min
servings   5
protein    18 g
pantry     94/100

categorybreakfastdietpescatarianleveleasykcal581

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal late-night ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.