$ cat recipes/signal-lunchbox-indian-spinach-feta-overnight-oat-cup-094134.md

Signal Lunchbox Indian Spinach Feta Overnight Oat Cup No. 094134

Name: Signal Lunchbox Indian Spinach Feta Overnight Oat Cup No. 094134
Prep time: 13 min
Cook time: 19 min
Total time: 32 min
Yield: 5 servings
Ingredients: signal lunchbox indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Signal Lunchbox Indian Spinach Feta Overnight Oat Cup No. 094134 is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Signal Lunchbox Indian Spinach Feta Overnight Oat Cup No. 094134

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       13 min
cook       19 min
total      32 min
servings   5
protein    42 g
pantry     66/100

categorybreakfastdietpescatarianleveleasykcal191

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal lunchbox indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.