$ cat recipes/signal-market-day-mediterranean-spinach-feta-breakfast-wrap-stack-096224.md

Signal Market-Day Mediterranean Spinach Feta Breakfast Wrap Stack No. 096224

Name: Signal Market-Day Mediterranean Spinach Feta Breakfast Wrap Stack No. 096224
Prep time: 13 min
Cook time: 19 min
Total time: 32 min
Yield: 5 servings
Ingredients: signal market-day mediterranean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Signal Market-Day Mediterranean Spinach Feta Breakfast Wrap Stack No. 096224 is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Signal Market-Day Mediterranean Spinach Feta Breakfast Wrap Stack No. 096224

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       13 min
cook       19 min
total      32 min
servings   5
protein    42 g
pantry     96/100

categorybreakfastdietpescatarianleveleasykcal591

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal market-day mediterranean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.