$ cat recipes/signal-rainy-day-british-sesame-ginger-egg-bake-094309.md

Signal Rainy-Day British Sesame Ginger Egg Bake No. 094309

Name: Signal Rainy-Day British Sesame Ginger Egg Bake No. 094309
Prep time: 10 min
Cook time: 28 min
Total time: 38 min
Yield: 5 servings
Ingredients: signal rainy-day british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Signal Rainy-Day British Sesame Ginger Egg Bake No. 094309 is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Signal Rainy-Day British Sesame Ginger Egg Bake No. 094309

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       10 min
cook       28 min
total      38 min
servings   5
protein    43 g
pantry     64/100

categorybreakfastdietpescatarianleveleasykcal296

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal rainy-day british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.