$ cat recipes/signal-rainy-day-british-sesame-ginger-scramble-bake-094304.md

Signal Rainy-Day British Sesame Ginger Scramble Bake No. 094304

Name: Signal Rainy-Day British Sesame Ginger Scramble Bake No. 094304
Prep time: 17 min
Cook time: 31 min
Total time: 48 min
Yield: 5 servings
Ingredients: signal rainy-day british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Signal Rainy-Day British Sesame Ginger Scramble Bake No. 094304 is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Signal Rainy-Day British Sesame Ginger Scramble Bake No. 094304

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       17 min
cook       31 min
total      48 min
servings   5
protein    18 g
pantry     91/100

categorybreakfastdietpescatarianleveleasykcal601

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal rainy-day british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.