$ cat recipes/signal-spring-brazilian-sweet-potato-smoothie-plate-095169.md

Signal Spring Brazilian Sweet Potato Smoothie Plate No. 095169

Name: Signal Spring Brazilian Sweet Potato Smoothie Plate No. 095169
Prep time: 16 min
Cook time: 44 min
Total time: 60 min
Yield: 5 servings
Ingredients: signal spring brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Signal Spring Brazilian Sweet Potato Smoothie Plate No. 095169 is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Signal Spring Brazilian Sweet Potato Smoothie Plate No. 095169

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       16 min
cook       44 min
total      60 min
servings   5
protein    11 g
pantry     94/100

categorybreakfastdietpescatarianleveleasykcal266

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal spring brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.