$ cat recipes/signal-spring-japanese-sweet-potato-yogurt-cup-cup-098434.md

Signal Spring Japanese Sweet Potato Yogurt Cup Cup No. 098434

Name: Signal Spring Japanese Sweet Potato Yogurt Cup Cup No. 098434
Prep time: 21 min
Cook time: 23 min
Total time: 44 min
Yield: 5 servings
Ingredients: signal spring japanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Signal Spring Japanese Sweet Potato Yogurt Cup Cup No. 098434 is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Signal Spring Japanese Sweet Potato Yogurt Cup Cup No. 098434

^_^ cozy
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       21 min
cook       23 min
total      44 min
servings   5
protein    34 g
pantry     93/100

categorybreakfastdietpescatarianleveleasykcal531

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal spring japanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.