$ cat recipes/signal-spring-korean-miso-scallion-egg-cup-093884.md

Signal Spring Korean Miso Scallion Egg Cup No. 093884

Name: Signal Spring Korean Miso Scallion Egg Cup No. 093884
Prep time: 11 min
Cook time: 17 min
Total time: 28 min
Yield: 5 servings
Ingredients: signal spring korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Signal Spring Korean Miso Scallion Egg Cup No. 093884 is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Signal Spring Korean Miso Scallion Egg Cup No. 093884

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       11 min
cook       17 min
total      28 min
servings   5
protein    8 g
pantry     63/100

categorybreakfastdietpescatarianleveleasykcal251

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal spring korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.