$ cat recipes/signal-spring-taiwanese-miso-scallion-breakfast-wrap-hash-097244.md

Signal Spring Taiwanese Miso Scallion Breakfast Wrap Hash No. 097244

Name: Signal Spring Taiwanese Miso Scallion Breakfast Wrap Hash No. 097244
Prep time: 15 min
Cook time: 15 min
Total time: 30 min
Yield: 5 servings
Ingredients: signal spring taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Signal Spring Taiwanese Miso Scallion Breakfast Wrap Hash No. 097244 is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Signal Spring Taiwanese Miso Scallion Breakfast Wrap Hash No. 097244

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       15 min
cook       15 min
total      30 min
servings   5
protein    12 g
pantry     82/100

categorybreakfastdietpescatarianleveleasykcal601

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal spring taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.