$ cat recipes/signal-summer-korean-sweet-potato-scramble-hash-093899.md

Signal Summer Korean Sweet Potato Scramble Hash No. 093899

Name: Signal Summer Korean Sweet Potato Scramble Hash No. 093899
Prep time: 12 min
Cook time: 8 min
Total time: 20 min
Yield: 5 servings
Ingredients: signal summer korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Signal Summer Korean Sweet Potato Scramble Hash No. 093899 is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Signal Summer Korean Sweet Potato Scramble Hash No. 093899

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       12 min
cook       8 min
total      20 min
servings   5
protein    7 g
pantry     64/100

categorybreakfastdietpescatarianlevelmediumkcal316

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal summer korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.