$ cat recipes/signal-summer-taiwanese-coconut-lime-smoothie-hash-093694.md

Signal Summer Taiwanese Coconut Lime Smoothie Hash No. 093694

Name: Signal Summer Taiwanese Coconut Lime Smoothie Hash No. 093694
Prep time: 13 min
Cook time: 17 min
Total time: 30 min
Yield: 5 servings
Ingredients: signal summer taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Signal Summer Taiwanese Coconut Lime Smoothie Hash No. 093694 is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Signal Summer Taiwanese Coconut Lime Smoothie Hash No. 093694

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       13 min
cook       17 min
total      30 min
servings   5
protein    8 g
pantry     64/100

categorybreakfastdietpescatarianleveleasykcal571

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal summer taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.