$ cat recipes/signal-sunday-brazilian-sesame-ginger-toast-cup-091589.md

Signal Sunday Brazilian Sesame Ginger Toast Cup No. 091589

Name: Signal Sunday Brazilian Sesame Ginger Toast Cup No. 091589
Prep time: 12 min
Cook time: 26 min
Total time: 38 min
Yield: 5 servings
Ingredients: signal sunday brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Signal Sunday Brazilian Sesame Ginger Toast Cup No. 091589 is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Signal Sunday Brazilian Sesame Ginger Toast Cup No. 091589

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       12 min
cook       26 min
total      38 min
servings   5
protein    9 g
pantry     74/100

categorybreakfastdietpescatarianlevelmediumkcal596

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal sunday brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.