$ cat recipes/signal-sunday-brazilian-sesame-ginger-toast-cup-096034.md

Signal Sunday Brazilian Sesame Ginger Toast Cup No. 096034

Name: Signal Sunday Brazilian Sesame Ginger Toast Cup No. 096034
Prep time: 15 min
Cook time: 19 min
Total time: 34 min
Yield: 5 servings
Ingredients: signal sunday brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Signal Sunday Brazilian Sesame Ginger Toast Cup No. 096034 is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Signal Sunday Brazilian Sesame Ginger Toast Cup No. 096034

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       15 min
cook       19 min
total      34 min
servings   5
protein    42 g
pantry     97/100

categorybreakfastdietpescatarianlevelmediumkcal421

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal sunday brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.