$ cat recipes/signal-sunday-korean-lemon-herb-overnight-oat-hash-090194.md

Signal Sunday Korean Lemon Herb Overnight Oat Hash No. 090194

Name: Signal Sunday Korean Lemon Herb Overnight Oat Hash No. 090194
Prep time: 7 min
Cook time: 27 min
Total time: 34 min
Yield: 5 servings
Ingredients: signal sunday korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Signal Sunday Korean Lemon Herb Overnight Oat Hash No. 090194 is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

athleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Signal Sunday Korean Lemon Herb Overnight Oat Hash No. 090194

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       7 min
cook       27 min
total      34 min
servings   5
protein    26 g
pantry     63/100

categorybreakfastdietpescatarianleveleasykcal431

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal sunday korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.