$ cat recipes/signal-sunday-korean-lemon-herb-smoothie-hash-090199.md

Signal Sunday Korean Lemon Herb Smoothie Hash No. 090199

Name: Signal Sunday Korean Lemon Herb Smoothie Hash No. 090199
Prep time: 22 min
Cook time: 24 min
Total time: 46 min
Yield: 5 servings
Ingredients: signal sunday korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Signal Sunday Korean Lemon Herb Smoothie Hash No. 090199 is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Signal Sunday Korean Lemon Herb Smoothie Hash No. 090199

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       22 min
cook       24 min
total      46 min
servings   5
protein    13 g
pantry     77/100

categorybreakfastdietpescatarianleveleasykcal616

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal sunday korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.