$ cat recipes/signal-sunday-korean-spinach-feta-scramble-plate-093869.md

Signal Sunday Korean Spinach Feta Scramble Plate No. 093869

Name: Signal Sunday Korean Spinach Feta Scramble Plate No. 093869
Prep time: 10 min
Cook time: 26 min
Total time: 36 min
Yield: 5 servings
Ingredients: signal sunday korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Signal Sunday Korean Spinach Feta Scramble Plate No. 093869 is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Signal Sunday Korean Spinach Feta Scramble Plate No. 093869

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       10 min
cook       26 min
total      36 min
servings   5
protein    9 g
pantry     62/100

categorybreakfastdietpescatarianleveleasykcal676

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal sunday korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.