$ cat recipes/signal-sunday-mexican-spinach-feta-pancake-bake-094954.md

Signal Sunday Mexican Spinach Feta Pancake Bake No. 094954

Name: Signal Sunday Mexican Spinach Feta Pancake Bake No. 094954
Prep time: 9 min
Cook time: 21 min
Total time: 30 min
Yield: 5 servings
Ingredients: signal sunday mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Signal Sunday Mexican Spinach Feta Pancake Bake No. 094954 is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Signal Sunday Mexican Spinach Feta Pancake Bake No. 094954

^_^ cozy
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       9 min
cook       21 min
total      30 min
servings   5
protein    38 g
pantry     66/100

categorybreakfastdietpescatarianleveleasykcal641

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal sunday mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.