$ cat recipes/signal-winter-korean-sesame-ginger-oat-plate-094764.md

Signal Winter Korean Sesame Ginger Oat Plate No. 094764

Name: Signal Winter Korean Sesame Ginger Oat Plate No. 094764
Prep time: 11 min
Cook time: 21 min
Total time: 32 min
Yield: 5 servings
Ingredients: signal winter korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Signal Winter Korean Sesame Ginger Oat Plate No. 094764 is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Signal Winter Korean Sesame Ginger Oat Plate No. 094764

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       11 min
cook       21 min
total      32 min
servings   5
protein    38 g
pantry     67/100

categorybreakfastdietpescatarianleveleasykcal471

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal winter korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.