$ cat recipes/spring-brazilian-pesto-kale-breakfast-wrap-stack-4274.md

Spring Brazilian Pesto Kale Breakfast Wrap Stack

Name: Spring Brazilian Pesto Kale Breakfast Wrap Stack
Prep time: 21 min
Cook time: 13 min
Total time: 34 min
Yield: 5 servings
Ingredients: spring brazilian pesto; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Spring Brazilian Pesto Kale Breakfast Wrap Stack is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Spring Brazilian Pesto Kale Breakfast Wrap Stack

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       21 min
cook       13 min
total      34 min
servings   5
protein    16 g
pantry     75/100

categorybreakfastdietpescatarianleveleasykcal511

$ price recipe --region auto

Estimating local basket...

Ingredients

spring brazilian pesto
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.