$ cat recipes/spring-korean-spinach-feta-breakfast-wrap-stack-4779.md

Spring Korean Spinach Feta Breakfast Wrap Stack

Name: Spring Korean Spinach Feta Breakfast Wrap Stack
Prep time: 18 min
Cook time: 14 min
Total time: 32 min
Yield: 5 servings
Ingredients: spring korean spinach; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Spring Korean Spinach Feta Breakfast Wrap Stack is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Spring Korean Spinach Feta Breakfast Wrap Stack

-_- calm
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       18 min
cook       14 min
total      32 min
servings   5
protein    33 g
pantry     95/100

categorybreakfastdietpescatarianleveleasykcal576

$ price recipe --region auto

Estimating local basket...

Ingredients

spring korean spinach
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.