$ cat recipes/spring-mediterranean-coconut-lime-smoothie-hash-2694.md

Spring Mediterranean Coconut Lime Smoothie Hash

Name: Spring Mediterranean Coconut Lime Smoothie Hash
Prep time: 11 min
Cook time: 11 min
Total time: 22 min
Yield: 5 servings
Ingredients: spring mediterranean coconut; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Spring Mediterranean Coconut Lime Smoothie Hash is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Spring Mediterranean Coconut Lime Smoothie Hash

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       11 min
cook       11 min
total      22 min
servings   5
protein    20 g
pantry     79/100

categorybreakfastdietpescatarianleveleasykcal361

$ price recipe --region auto

Estimating local basket...

Ingredients

spring mediterranean coconut
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.