$ cat recipes/spring-ontario-coconut-lime-breakfast-wrap-cup-3789.md

Spring Ontario Coconut Lime Breakfast Wrap Cup

Name: Spring Ontario Coconut Lime Breakfast Wrap Cup
Prep time: 18 min
Cook time: 38 min
Total time: 56 min
Yield: 5 servings
Ingredients: spring ontario coconut; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Spring Ontario Coconut Lime Breakfast Wrap Cup is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Spring Ontario Coconut Lime Breakfast Wrap Cup

-_- calm
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       18 min
cook       38 min
total      56 min
servings   5
protein    23 g
pantry     70/100

categorybreakfastdietpescatarianleveleasykcal206

$ price recipe --region auto

Estimating local basket...

Ingredients

spring ontario coconut
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.