$ cat recipes/spring-taiwanese-spinach-feta-smoothie-cup-3684.md

Spring Taiwanese Spinach Feta Smoothie Cup

Name: Spring Taiwanese Spinach Feta Smoothie Cup
Prep time: 11 min
Cook time: 25 min
Total time: 36 min
Yield: 5 servings
Ingredients: spring taiwanese spinach; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Spring Taiwanese Spinach Feta Smoothie Cup is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Spring Taiwanese Spinach Feta Smoothie Cup

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       11 min
cook       25 min
total      36 min
servings   5
protein    30 g
pantry     63/100

categorybreakfastdietpescatarianleveleasykcal241

$ price recipe --region auto

Estimating local basket...

Ingredients

spring taiwanese spinach
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.