$ cat recipes/spring-taiwanese-tomato-basil-egg-muffin-stack-4574.md

Spring Taiwanese Tomato Basil Egg Muffin Stack

Name: Spring Taiwanese Tomato Basil Egg Muffin Stack
Prep time: 19 min
Cook time: 23 min
Total time: 42 min
Yield: 5 servings
Ingredients: spring taiwanese tomato; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Spring Taiwanese Tomato Basil Egg Muffin Stack is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Spring Taiwanese Tomato Basil Egg Muffin Stack

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       19 min
cook       23 min
total      42 min
servings   5
protein    34 g
pantry     95/100

categorybreakfastdietpescatarianleveleasykcal341

$ price recipe --region auto

Estimating local basket...

Ingredients

spring taiwanese tomato
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.