$ cat recipes/summer-french-lemon-herb-overnight-oat-hash-3194.md

Summer French Lemon Herb Overnight Oat Hash

Name: Summer French Lemon Herb Overnight Oat Hash
Prep time: 15 min
Cook time: 15 min
Total time: 30 min
Yield: 5 servings
Ingredients: summer french lemon; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Summer French Lemon Herb Overnight Oat Hash is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Summer French Lemon Herb Overnight Oat Hash

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       15 min
cook       15 min
total      30 min
servings   5
protein    12 g
pantry     85/100

categorybreakfastdietpescatarianleveleasykcal241

$ price recipe --region auto

Estimating local basket...

Ingredients

summer french lemon
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.