$ cat recipes/summer-japanese-corn-pepper-yogurt-cup-hash-3999.md

Summer Japanese Corn Pepper Yogurt Cup Hash

Name: Summer Japanese Corn Pepper Yogurt Cup Hash
Prep time: 10 min
Cook time: 26 min
Total time: 36 min
Yield: 5 servings
Ingredients: summer japanese corn; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summer Japanese Corn Pepper Yogurt Cup Hash is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Summer Japanese Corn Pepper Yogurt Cup Hash

-_- calm
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       10 min
cook       26 min
total      36 min
servings   5
protein    9 g
pantry     84/100

categorybreakfastdietpescatarianleveleasykcal626

$ price recipe --region auto

Estimating local basket...

Ingredients

summer japanese corn
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.