$ cat recipes/summer-mediterranean-spinach-feta-egg-muffin-hash-3594.md

Summer Mediterranean Spinach Feta Egg Muffin Hash

Name: Summer Mediterranean Spinach Feta Egg Muffin Hash
Prep time: 27 min
Cook time: 41 min
Total time: 68 min
Yield: 5 servings
Ingredients: summer mediterranean spinach; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Summer Mediterranean Spinach Feta Egg Muffin Hash is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Summer Mediterranean Spinach Feta Egg Muffin Hash

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       27 min
cook       41 min
total      68 min
servings   5
protein    36 g
pantry     98/100

categorybreakfastdietpescatarianleveleasykcal341

$ price recipe --region auto

Estimating local basket...

Ingredients

summer mediterranean spinach
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.