$ cat recipes/summer-ontario-spinach-feta-overnight-oat-cup-4689.md

Summer Ontario Spinach Feta Overnight Oat Cup

Name: Summer Ontario Spinach Feta Overnight Oat Cup
Prep time: 12 min
Cook time: 30 min
Total time: 42 min
Yield: 5 servings
Ingredients: summer ontario spinach; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summer Ontario Spinach Feta Overnight Oat Cup is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Summer Ontario Spinach Feta Overnight Oat Cup

-_- calm
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       12 min
cook       30 min
total      42 min
servings   5
protein    39 g
pantry     89/100

categorybreakfastdietpescatarianleveleasykcal676

$ price recipe --region auto

Estimating local basket...

Ingredients

summer ontario spinach
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.