$ cat recipes/summit-fall-japanese-sesame-ginger-overnight-oat-stack-056679.md

Summit Fall Japanese Sesame Ginger Overnight Oat Stack No. 056679

Name: Summit Fall Japanese Sesame Ginger Overnight Oat Stack No. 056679
Prep time: 24 min
Cook time: 34 min
Total time: 58 min
Yield: 5 servings
Ingredients: summit fall japanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summit Fall Japanese Sesame Ginger Overnight Oat Stack No. 056679 is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Summit Fall Japanese Sesame Ginger Overnight Oat Stack No. 056679

-_- calm
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       24 min
cook       34 min
total      58 min
servings   5
protein    31 g
pantry     70/100

categorybreakfastdietpescatarianleveleasykcal566

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit fall japanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.