$ cat recipes/summit-fall-korean-lemon-herb-yogurt-cup-plate-057464.md

Summit Fall Korean Lemon Herb Yogurt Cup Plate No. 057464

Name: Summit Fall Korean Lemon Herb Yogurt Cup Plate No. 057464
Prep time: 25 min
Cook time: 19 min
Total time: 44 min
Yield: 5 servings
Ingredients: summit fall korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Summit Fall Korean Lemon Herb Yogurt Cup Plate No. 057464 is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Summit Fall Korean Lemon Herb Yogurt Cup Plate No. 057464

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       25 min
cook       19 min
total      44 min
servings   5
protein    42 g
pantry     95/100

categorybreakfastdietpescatarianlevelmediumkcal211

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit fall korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.